| 产品详情 |
| Edit |   |
| Antigenic Specificity | PEDFR/PNPLA2/ATGL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PEDFR/PNPLA2/ATGL Antibody from Novus Biologicals is a rabbit polyclonal antibody to PEDFR/PNPLA2/ATGL. This antibody reacts with human. The PEDFR/PNPLA2/ATGL Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PEDF R/PNPLA2/ATGL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA |
| Other Names | Adipose triglyceride lipase, ATGL1110001C14Rik, Calcium-independent phospholipase A2, Desnutrin, EC 3.1.1.3, FP17548, IPLA2-zeta, patatin-like phospholipase domain containing 2, patatin-like phospholipase domain-containing protein 2, patatin-like phospholipase domain-containing protein 2-like, PEDF-R, Pigment epithelium-derived factor, Transport-secretion protein 2, transport-secretion protein 2.2, triglyceride hydrolase, TTS2.2, TTS-2.2, TTS2DKFZp667M109 |
| Gene, Accession # | PNPLA2, Gene ID: 57104 |
| Catalog # | NBP2-57480 |
| Price | |
| Order / More Info | PEDFR/PNPLA2/ATGL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|