| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SOCS-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SOCS-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SOCS-1. This antibody reacts with human. The SOCS-1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SOCS-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI |
|---|
| Other Names | JABTec-interacting protein 3, JAK binding protein, JAK-binding protein, SOCS-1CIS1, SSI-1CISH1, SSI1cytokine-inducible SH2 protein 1, STAT induced SH3 protein 1, STAT-induced STAT inhibitor 1, suppressor of cytokine signaling 1, TIP-3, TIP3Cish1 |
|---|
| Gene, Accession # | SOCS1, Gene ID: 8651 |
|---|
| Catalog # | NBP2-56298 |
|---|
| Price | |
|---|
| Order / More Info | SOCS-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|