| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPSF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPSF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPSF1. This antibody reacts with human. The CPSF1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CPSF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AISLNITQKVHPVIWSLTSLPFDCTQALAVPKPIGGVVVFAVNSLLYLNQSVPPYGVALNSLTTGTTAFPLRT |
|---|
| Other Names | cleavage and polyadenylation specific factor 1, 160kD subunit, cleavage and polyadenylation specific factor 1, 160kDa, Cleavage and polyadenylation specificity factor 160 kDa subunit, cleavage and polyadenylation specificity factor subunit 1, CPSF 160 kDa subunit, CPSF160, HSU37012, P/cl.18, polyadenylation specificity factor |
|---|
| Gene, Accession # | CPSF1, Gene ID: 29894 |
|---|
| Catalog # | NBP2-57024 |
|---|
| Price | |
|---|
| Order / More Info | CPSF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|