| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPSF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPSF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPSF1. This antibody reacts with human. The CPSF1 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: 1 |
|---|
| Immunogen | Synthetic peptides corresponding to CPSF1(cleavage and polyadenylation specific factor 1, 160kDa) The peptide sequence was selected from the middle region of CPSF1. Peptide sequence GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE. |
|---|
| Other Names | cleavage and polyadenylation specific factor 1, 160kD subunit, cleavage and polyadenylation specific factor 1, 160kDa, Cleavage and polyadenylation specificity factor 160 kDa subunit, cleavage and polyadenylation specificity factor subunit 1, CPSF 160 kDa subunit, CPSF160, HSU37012, P/cl.18, polyadenylation specificity factor |
|---|
| Gene, Accession # | CPSF1, Gene ID: 29894, Accession: Q10570, SwissProt: Q10570 |
|---|
| Catalog # | NBP1-57434 |
|---|
| Price | |
|---|
| Order / More Info | CPSF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|