| 产品详情 |
| Edit |   |
| Antigenic Specificity | CPSF6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC reported in the literature (PMID 25517934). WB, ICC/IF reported in the literature (PMID: 23414560). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CPSF6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPSF6. This antibody reacts with human, mouse, rat. The CPSF6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN |
| Other Names | CFIM, CFIm68, CFIM68CPSF 68 kDa subunit, CFIMcleavage and polyadenylation specific factor 6, 68kD subunit, cleavage and polyadenylation specific factor 6, 68kDa, Cleavage and polyadenylation specificity factor 68 kDa subunit, cleavage and polyadenylation specificity factor subunit 6, HPBRII-4, HPBRII-7, pre-mRNA cleavage factor I, 68kD subunit, pre-mRNA cleavage factor Im (68kD), Pre-mRNA cleavage factor Im 68 kDa subunit, Protein HPBRII-4/7 |
| Gene, Accession # | CPSF6, Gene ID: 11052 |
| Catalog # | NBP1-85676-25ul |
| Price | |
| Order / More Info | CPSF6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23414560, 25517934 |
| 产品资料 |
|
|