| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPT1A |
|---|
| Clone | 1D3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPT1A Antibody (1D3) from Novus Biologicals is a mouse monoclonal antibody to CPT1A. This antibody reacts with human. The CPT1A Antibody (1D3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CPT1A (NP_001867.2 461 a.a. - 550 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP |
|---|
| Other Names | carnitine O-palmitoyltransferase 1, liver isoform, Carnitine O-palmitoyltransferase I, liver isoform, Carnitine palmitoyltransferase 1A, carnitine palmitoyltransferase 1A (liver), carnitine palmitoyltransferase I, liver, CPT I, CPT1, CPT1-LEC 2.3.1.21, CPTI-L, EC 2.3.1, L-CPT1 |
|---|
| Gene, Accession # | CPT1A, Gene ID: 1374, Accession: NP_001867, SwissProt: NP_001867 |
|---|
| Catalog # | H00001374-M02 |
|---|
| Price | |
|---|
| Order / More Info | CPT1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|