| 产品详情 |
| Edit |   |
| Antigenic Specificity | PKN2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Recommended conditions for ICC/IF: Fixation/Permeabilization: PFA/Triton X-100, Recommended conditions for IHC: Retrieval method: HIER pH6 |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PKN2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PKN2. This antibody reacts with human. The PKN2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFR |
| Other Names | cardiolipin-activated protein kinase Pak2, EC 2.7.11, EC 2.7.11.13, Pak-2, PAK2, PRK2MGC150606, PRKCL2PRO2042, Protein kinase C-like 2MGC71074, protein kinase N2, Protein-kinase C-related kinase 2, serine/threonine-protein kinase N2 |
| Gene, Accession # | PKN2, Gene ID: 5586 |
| Catalog # | NBP2-68736 |
| Price | |
| Order / More Info | PKN2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|