| Edit |   |
|---|
| Antigenic Specificity | BMP-5 |
|---|
| Clone | 3G11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BMP-5 Antibody (3G11) from Novus Biologicals is a mouse monoclonal antibody to BMP-5. This antibody reacts with human. The BMP-5 Antibody (3G11) has been validated for the following applications: ELISA. |
|---|
| Immunogen | BMP5 (NP_066551.1 341 a.a. - 440 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL |
|---|
| Other Names | BMP-5, bone morphogenetic protein 5, MGC34244 |
|---|
| Gene, Accession # | BMP5, Gene ID: 653, Accession: NP_066551, SwissProt: NP_066551 |
|---|
| Catalog # | H00000653-M03 |
|---|
| Price | |
|---|
| Order / More Info | BMP-5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|