| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MED30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MED30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED30. This antibody reacts with human. The MED30 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MED30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY |
|---|
| Other Names | mediator complex subunit 30TRAP/Mediator complex component TRAP25, mediator of RNA polymerase II transcription subunit 30, putative mediator of RNA polymerase II transcription subunit 30, THRAP6MGC9890, thyroid hormone receptor associated protein 6, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein complex 25 kDa component, Trap25, TRAP25MED30S |
|---|
| Gene, Accession # | MED30, Gene ID: 90390 |
|---|
| Catalog # | NBP2-58363 |
|---|
| Price | |
|---|
| Order / More Info | MED30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|