| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MED31 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MED31 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED31. This antibody reacts with human. The MED31 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MED31 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQC |
|---|
| Other Names | CGI-125, FLJ27436, FLJ36714, hSOH1, mediator complex subunit 313110004H13Rik, Mediator complex subunit SOH1, mediator of RNA polymerase II transcription subunit 31, mediator of RNA polymerase II transcription, subunit 31 homolog, mediator of RNA polymerase II transcription, subunit 31 homolog (S. cerevisiae), SOH1 |
|---|
| Gene, Accession # | MED31, Gene ID: 51003 |
|---|
| Catalog # | NBP1-84519 |
|---|
| Price | |
|---|
| Order / More Info | MED31 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|