| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NIPSNAP3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NIPSNAP3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to NIPSNAP3A. This antibody reacts with human. The NIPSNAP3A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NIPSNAP3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIP |
|---|
| Other Names | DKFZp564D177, FLJ13953, HSPC299, MGC14553, nipsnap homolog 3A (C. elegans), NipSnap3A, NipSnap4, protein NipSnap homolog 3A, Protein NipSnap homolog 4, Target for Salmonella secreted protein C, TassC |
|---|
| Gene, Accession # | NIPSNAP3A, Gene ID: 25934, Accession: Q9BS92 |
|---|
| Catalog # | NBP2-46674 |
|---|
| Price | |
|---|
| Order / More Info | NIPSNAP3A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|