| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NIR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NIR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NIR2. This antibody reacts with human. The NIR2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NIR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAA |
|---|
| Other Names | DRES9NIR-2, Drosophila retinal degeneration B homolog, FLJ44997, membrane-associated phosphatidylinositol transfer protein 1, NIR2PITPNM, phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2, PITPnm 1, Rd9, RDGB, RDGB1, RDGBA, RDGBA1, retinal degeneration B alpha 1 |
|---|
| Gene, Accession # | PITPNM1, Gene ID: 9600 |
|---|
| Catalog # | NBP2-56687 |
|---|
| Price | |
|---|
| Order / More Info | NIR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|