| Edit |   |
|---|
| Antigenic Specificity | ANKMY2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKMY2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKMY2. This antibody reacts with human. The ANKMY2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ANKMY2(ankyrin repeat and MYND domain containing 2) Antibody(against the N terminal of ANKMY2. Peptide sequence DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL. |
|---|
| Other Names | ankyrin repeat and MYND domain containing 2, ankyrin repeat and MYND domain-containing protein 2, DKFZP564O043, ZMYND20 |
|---|
| Gene, Accession # | ANKMY2, Gene ID: 57037, Accession: Q8IV38, SwissProt: Q8IV38 |
|---|
| Catalog # | NBP1-56599 |
|---|
| Price | |
|---|
| Order / More Info | ANKMY2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|