Edit |   |
Antigenic Specificity | PHKG2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 72%, rat 69%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human PHKG2 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG |
Other Names | phosphorylase kinase, gamma 2 (testis) |
Gene, Accession # | Gene ID: 5261, UniProt: P15735, ENSG00000156873 |
Catalog # | HPA068751 |
Price | |
Order / More Info | PHKG2 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |