Edit |   |
Antigenic Specificity | ADO |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 93%, rat 28%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines., Recombinant expression validation in WB using target protein overexpression. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human ADO polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAG |
Other Names | 2-aminoethanethiol (cysteamine) dioxygenase, C10orf22, FLJ14547 |
Gene, Accession # | Gene ID: 84890, UniProt: Q96SZ5, ENSG00000181915 |
Catalog # | HPA039194 |
Price | |
Order / More Info | ADO Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |