Edit |   |
Antigenic Specificity | NDUFS5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 77%, rat 75%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human NDUFS5 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK |
Other Names | NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase), CI-15k |
Gene, Accession # | Gene ID: 4725, UniProt: O43920, ENSG00000168653 |
Catalog # | HPA042582 |
Price | |
Order / More Info | NDUFS5 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |