| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-1 RI |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-1 RI Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-1 RI. This antibody reacts with human. The IL-1 RI Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL-1RI/IL-1R1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLF |
|---|
| Other Names | CD121 antigen-like family member A, CD121a antigen, IL1R, IL1R1, IL1RT1, IL-1RT1, IL-1RT-1, Interleukin 1 Receptor 1, interleukin 1 receptor, type I, interleukin receptor 1, interleukin-1 receptor type 1, p80 |
|---|
| Gene, Accession # | IL1R1, Gene ID: 3554 |
|---|
| Catalog # | NBP2-48589 |
|---|
| Price | |
|---|
| Order / More Info | IL-1 RI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|