Edit |   |
Antigenic Specificity | TSPYL6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 33%, rat 32%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human TSPYL6 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KALETCGAGRSESEVIAEGKAEDVKPEECAMFSAPVDEKPGGEEMDVAEENRAIDEVNREAG |
Other Names | TSPY-like 6 |
Gene, Accession # | Gene ID: 388951, UniProt: Q8N831, ENSG00000178021 |
Catalog # | HPA034699 |
Price | |
Order / More Info | TSPYL6 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |