| Edit |   |
|---|
| Antigenic Specificity | DDX60L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, horse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-DDX60L Antibody |
|---|
| Immunogen | The immunogen for Anti-DDX60L Antibody is: synthetic peptide directed towards the N-terminal region of Human DDX60L. Synthetic peptide located within the following region: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKW |
|---|
| Other Names | DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like |
|---|
| Gene, Accession # | DDX6L, Accession: NM_001012967 |
|---|
| Catalog # | TA332265 |
|---|
| Price | |
|---|
| Order / More Info | DDX60L Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|