| Edit |   |
|---|
| Antigenic Specificity | SDHD |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 78%, rat 76%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human SDHD polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW |
|---|
| Other Names | succinate dehydrogenase complex subunit D, cybS, PGL, PGL1 |
|---|
| Gene, Accession # | Gene ID: 6392, UniProt: O14521, ENSG00000204370 |
|---|
| Catalog # | HPA045727 |
|---|
| Price | |
|---|
| Order / More Info | SDHD Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|