Edit |   |
Antigenic Specificity | HSD3B1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 84%, rat 89%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human HSD3B1 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKT |
Other Names | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, HSD3B, HSDB3, SDR11E1 |
Gene, Accession # | Gene ID: 3283, UniProt: P14060, ENSG00000203857 |
Catalog # | HPA043264 |
Price | |
Order / More Info | HSD3B1 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |