| Edit |   |
| Antigenic Specificity | RAB40C - C-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-RAB40C Antibody - C-terminal region |
| Immunogen | The immunogen for Anti-RAB40C antibody is: synthetic peptide directed towards the C-terminal region of Human RAB40C. Synthetic peptide located within the following region: MANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRS |
| Other Names | RARL, RASL8C, RAB40C, member RAS oncogene family |
| Gene, Accession # | RB40C, Accession: NM_021168 |
| Catalog # | TA344733 |
| Price | |
| Order / More Info | RAB40C - C-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |