| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RP5-1077B9.4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RP5-1077B9.4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RP5-1077B9.4. This antibody reacts with human. The RP5-1077B9.4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RP5-1077B9 |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SDTLALPRHCLLGWDIFPPKSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKP |
|---|
| Other Names | FLJ12438, FLJ38609, IGFBP2-binding protein, IGFBP-2-Binding Protein, IIp45, invasion inhibitory protein 45, Invasion-inhibitory protein 45, migration and invasion inhibitory protein, migration and invasion-inhibitory protein |
|---|
| Gene, Accession # | MIIP, Gene ID: 60672 |
|---|
| Catalog # | NBP1-87394 |
|---|
| Price | |
|---|
| Order / More Info | RP5-1077B9.4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|