| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RPB9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPB9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPB9. This antibody reacts with human. The RPB9 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RPB9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCT |
|---|
| Other Names | DNA-directed RNA polymerase II 14.5 kDa polypeptide, DNA-directed RNA polymerase II subunit I, DNA-directed RNA polymerase II subunit RPB9, hRPB14.5, polymerase (RNA) II (DNA directed) polypeptide I (14.5kD), polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa, RNA polymerase II 14.5 kDa subunit, RNA polymerase II subunit B9, RPB14.5, RPB9 |
|---|
| Gene, Accession # | POLR2I, Gene ID: 5438 |
|---|
| Catalog # | NBP2-58387 |
|---|
| Price | |
|---|
| Order / More Info | RPB9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|