| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DAGLA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DAGLA Antibody from Novus Biologicals is a rabbit polyclonal antibody to DAGLA. This antibody reacts with human. The DAGLA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DAGLA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPL |
|---|
| Other Names | C11orf11, DAGL(ALPHA), DAGLALPHA, DGL-alpha, diacylglycerol lipase, alpha, EC 3.1.1.-, KIAA0659, Neural stem cell-derived dendrite regulator, NSDDRchromosome 11 open reading frame 11, sn1-specific diacylglycerol lipase alpha |
|---|
| Gene, Accession # | DAGLA, Gene ID: 747, Accession: Q9Y4D2, SwissProt: Q9Y4D2 |
|---|
| Catalog # | NBP2-31856 |
|---|
| Price | |
|---|
| Order / More Info | DAGLA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26977322 |
|---|
| 产品资料 |
|
|