| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cytokeratin, HMW |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC, ICC/IF reported in scientific literature (PMID: 25340345). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cytokeratin, HMW Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytokeratin, HMW. This antibody reacts with human, mouse. The Cytokeratin, HMW Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cytokeratin, HMW antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFK |
| Other Names | CK-2P, cytokeratin 2, Cytokeratin-2P, HUMCYT2A, K2P, K76, keratin 76, keratin, type II cytoskeletal 2 oral, Keratin-76, KRT2Bcytokeratin-2P, KRT2Pkeratin 2p, KRT76, Type-II keratin Kb9 |
| Gene, Accession # | KRT76, Gene ID: 51350 |
| Catalog # | NBP1-81647 |
| Price | |
| Order / More Info | Cytokeratin, HMW Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23936238, 25340345 |
| 产品资料 |
|
|