| 产品详情 |
| Edit |   |
| Antigenic Specificity | ZFAND2B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZFAND2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFAND2B. This antibody reacts with human, mouse. The ZFAND2B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse ZFAND2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKH |
| Other Names | AIRAP-like protein, AN1-type 2B, AN1-type zinc finger protein 2B, arsenite inducible RNA associated protein-like, Arsenite-inducible RNA-associated protein-like protein, zinc finger, AN1-type domain 2B |
| Gene, Accession # | ZFAND2B, Gene ID: 130617 |
| Catalog # | NBP1-89174 |
| Price | |
| Order / More Info | ZFAND2B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26692333 |
| 产品资料 |
|
|