| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRPM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRPM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRPM2. This antibody reacts with human, mouse. The TRPM2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to TRPM2(transient receptor potential cation channel, subfamily M, member 2) The peptide sequence was selected from the N terminal of TRPM2. Peptide sequence VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQ |
|---|
| Other Names | EC 3.6.1.13, EREG1MGC133383, Estrogen-responsive element-associated gene 1 protein, KNP3LTrpC-2, Long transient receptor potential channel 2, LTrpC2, LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2, NUDT9H, NUDT9L1, transient receptor potential cation channel, subfamily M, member 2, Transient receptor potential channel 7, TrpC7 |
|---|
| Gene, Accession # | TRPM2, Gene ID: 7226, Accession: O94759, SwissProt: O94759 |
|---|
| Catalog # | NBP1-59618 |
|---|
| Price | |
|---|
| Order / More Info | TRPM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|