| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRPM4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRPM4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRPM4. This antibody reacts with human. The TRPM4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TRPM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETL EDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKE |
|---|
| Other Names | Calcium-activated non-selective cation channel 1, FLJ20041, hTRPM4, Long transient receptor potential channel 4, LTrpC-4, LTRPC4, melastatin-4, PFHB1B, transient receptor potential cation channel subfamily M member 4, transient receptor potential cation channel, subfamily M, member 4, TRPM4B |
|---|
| Gene, Accession # | TRPM4, Gene ID: 54795 |
|---|
| Catalog # | NBP2-13487 |
|---|
| Price | |
|---|
| Order / More Info | TRPM4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|