| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glut3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID 25948295) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glut3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glut3. This antibody reacts with human. The Glut3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Glut3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT |
|---|
| Other Names | FLJ90380, GLUT-3, GLUT3Glucose transporter type 3, brain, solute carrier family 2 (facilitated glucose transporter), member 3, solute carrier family 2, facilitated glucose transporter member 3 |
|---|
| Gene, Accession # | SLC2A3, Gene ID: 6515, Accession: P11169, SwissProt: P11169 |
|---|
| Catalog # | NBP1-89762 |
|---|
| Price | |
|---|
| Order / More Info | Glut3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25751139, 25948295 |
|---|
| 产品资料 |
|
|