| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VSIG3/IGSF11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VSIG3/IGSF11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VSIG3/IGSF11. This antibody reacts with human. The VSIG3/IGSF11 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to IGSF11(immunoglobulin superfamily, member 11) The peptide sequence was selected from the middle region of IGSF11. Peptide sequence EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL. |
|---|
| Other Names | Brain and testis-specific immunoglobulin superfamily protein, Bt-IGSF, BTIGSF, cancer/testis antigen 119, CT119, CXADR like 1, CXADRL1, IgSF11, Igsf13, immunoglobulin superfamily member 11, immunoglobulin superfamily, member 11, MGC35227, V-set and immunoglobulin domain containing 3, V-set and immunoglobulin domain-containing protein 3, VSIG3brain and testis-specific immunoglobin superfamily protein |
|---|
| Gene, Accession # | IGSF11, Gene ID: 152404, Accession: Q5DX21, SwissProt: Q5DX21 |
|---|
| Catalog # | NBP1-59503 |
|---|
| Price | |
|---|
| Order / More Info | VSIG3/IGSF11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|