| Edit |   |
|---|
| Antigenic Specificity | ACCSL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACCSL Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACCSL. This antibody reacts with human. The ACCSL Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LOC390110(hypothetical protein) The peptide sequence was selected from the N terminal of LOC390110 (NP_001027025). Peptide sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR. |
|---|
| Other Names | 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like, ACC synthase-like protein 2,1-aminocyclopropane-1-carboxylate synthase-like protein 2 |
|---|
| Gene, Accession # | ACCSL, Gene ID: 390110, Accession: Q4AC99, SwissProt: Q4AC99 |
|---|
| Catalog # | NBP1-70401-20ul |
|---|
| Price | |
|---|
| Order / More Info | ACCSL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|