| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC35B2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC35B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC35B2. This antibody reacts with human. The SLC35B2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC35B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT |
|---|
| Other Names | adenosine 3'-phospho 5'-phosphosulfate transporter 1, PAPS transporter 1, PAPST13'-phosphoadenosine 5'-phosphosulfate transporter, Putative MAPK-activating protein PM15, Putative NF-kappa-B-activating protein 48, SLL, Solute carrier family 35 member B2, solute carrier family 35 member B2 variant 2, solute carrier family 35, member B2, UGTrel4 |
|---|
| Gene, Accession # | SLC35B2, Gene ID: 347734 |
|---|
| Catalog # | NBP1-80641 |
|---|
| Price | |
|---|
| Order / More Info | SLC35B2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|