| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC35B3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC35B3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC35B3. This antibody reacts with human. The SLC35B3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC35B3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL |
|---|
| Other Names | 3' phosphoadenosine 5' phosphosulfate transporter 2, adenosine 3'-phospho 5'-phosphosulfate transporter 2, C6orf196, CGI-19, chromosome 6 open reading frame 196, PAPS transporter 2, PAPST2dJ453H5.1,3'-phosphoadenosine 5'-phosphosulfate transporter, Solute carrier family 35 member B3, solute carrier family 35, member B3 |
|---|
| Gene, Accession # | SLC35B3, Gene ID: 51000, Accession: Q9H1N7, SwissProt: Q9H1N7 |
|---|
| Catalog # | NBP2-37965 |
|---|
| Price | |
|---|
| Order / More Info | SLC35B3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|