| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC35C2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC35C2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC35C2. This antibody reacts with human. The SLC35C2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC35C2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ |
|---|
| Other Names | bA394O2.1, C20orf5, CGI-15, FLJ37039, FLJ46434, MGC20633, MGC32079, MGC39183, ovarian cancer overexpressed 1, Ovarian cancer-overexpressed gene 1 protein, OVCOV1, solute carrier family 35 member C2, solute carrier family 35, member C2 |
|---|
| Gene, Accession # | SLC35C2, Gene ID: 51006, Accession: Q9NQQ7, SwissProt: Q9NQQ7 |
|---|
| Catalog # | NBP2-32008 |
|---|
| Price | |
|---|
| Order / More Info | SLC35C2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|