| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DENND5B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DENND5B Antibody from Novus Biologicals is a rabbit polyclonal antibody to DENND5B. This antibody reacts with human. The DENND5B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DENND5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK |
|---|
| Other Names | DENN domain-containing protein 5B, DENN/MADD domain containing 5B, DKFZp686P1174, FLJ41648, FLJ43333, MGC24039, Rab6IP1-like protein |
|---|
| Gene, Accession # | DENND5B, Gene ID: 160518, Accession: Q6ZUT9, SwissProt: Q6ZUT9 |
|---|
| Catalog # | NBP2-31971 |
|---|
| Price | |
|---|
| Order / More Info | DENND5B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|