| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PCSK1N |
|---|
| Clone | 1E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCSK1N Antibody (1E9) from Novus Biologicals is a mouse monoclonal antibody to PCSK1N. This antibody reacts with human. The PCSK1N Antibody (1E9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | PCSK1N (NP_037403, 173 a.a. 260a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP |
|---|
| Other Names | granin-like neuroendocrine peptide, Proprotein convertase 1 inhibitor, proprotein convertase subtilisin/kexin type 1 inhibitorPROSAAS, proSAAS, pro-SAAS, SAAS |
|---|
| Gene, Accession # | PCSK1N, Gene ID: 27344, Accession: NP_037403, SwissProt: NP_037403 |
|---|
| Catalog # | H00027344-M02 |
|---|
| Price | |
|---|
| Order / More Info | PCSK1N Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23056534 |
|---|
| 产品资料 |
|
|