| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NPAT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NPAT Antibody from Novus Biologicals is a rabbit polyclonal antibody to NPAT. This antibody reacts with human. The NPAT Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NPAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VSDKSIATDLGKKSEETTVPFPEESIVPAAKPCHRRVLCFDSTTAPVANTQGPNHKMVSQNKERNAVSFPNLDSPNVSSTL |
|---|
| Other Names | CAND3, E14, E14/NPAT, Nuclear Protein Of The Ataxia Telangiectasia Mutated Locus, Nuclear Protein Of The ATM Locus, Nuclear Protein, Ataxia-Telangiectasia Locus, Nuclear Protein, Coactivator Of Histone Transcription, Nuclear Protein, Co-Activator Of Histone Transcription, p220, Protein NPAT |
|---|
| Gene, Accession # | NPAT, Gene ID: 4863 |
|---|
| Catalog # | NBP2-56922 |
|---|
| Price | |
|---|
| Order / More Info | NPAT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|