| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACE/CD143 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACE/CD143 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACE/CD143. This antibody reacts with human. The ACE/CD143 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ACE/CD143 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQ |
|---|
| Other Names | ACE1angiotensin converting enzyme, somatic isoform, angiotensin I converting enzyme (peptidyl-dipeptidase A) 1, carboxycathepsin, CD143, CD143 antigen, DCP, DCP1angiotensin-converting enzyme, dipeptidyl carboxypeptidase 1, Dipeptidyl carboxypeptidase I, EC 3.2.1.-, EC 3.4.15.1, Kininase II, MGC26566, MVCD3, peptidase P, testicular ECA |
|---|
| Gene, Accession # | ACE, Gene ID: 1636 |
|---|
| Catalog # | NBP2-57207 |
|---|
| Price | |
|---|
| Order / More Info | ACE/CD143 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|