| 产品详情 |
| Edit |   |
| Antigenic Specificity | DC-SIGNR/CD299/CLEC4M |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DC-SIGNR/CD299/CLEC4M Antibody from Novus Biologicals is a rabbit polyclonal antibody to DC-SIGNR/CD299/CLEC4M. This antibody reacts with human. The DC-SIGNR/CD299/CLEC4M Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CLEC4M (C-type lectin domain family 4, member M) The peptide sequence was selected from the middle region of CLEC4M)(50ug). Peptide sequence NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS. |
| Other Names | CD209L1, CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2, CD299, CD299 antigenMGC129964, C-type lectin domain family 4, member M, DC-SIGN2CD209 antigen-like protein 1, DC-SIGNRDC-SIGN-related protein, DCSIGNRMGC47866, Dendritic cell-specific ICAM-3-grabbing non-integrin 2, HP10347, liver/lymph node-specific ICAM-3 grabbing non-integrin, Liver/lymph node-specific ICAM-3-grabbing non-integrin, L-SIGN, LSIGNC-type lectin domain family 4 member M, mannose binding C-type lectin DC-SIGNR |
| Gene, Accession # | CLEC4M, Gene ID: 10332, Accession: Q9H2X3, SwissProt: Q9H2X3 |
| Catalog # | NBP1-59183-20ul |
| Price | |
| Order / More Info | DC-SIGNR/CD299/CLEC4M Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|