| Edit |   |
|---|
| Antigenic Specificity | Calcium Channel Flower Homolog |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calcium Channel Flower Homolog Antibody from Novus Biologicals is a rabbit polyclonal antibody to Calcium Channel Flower Homolog. This antibody reacts with human. The Calcium Channel Flower Homolog Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE |
|---|
| Other Names | CACFD1, calcium channel flower domain containing 1, calcium channel flower homolog, chromosome 9 open reading frame 7, D9S2135, FLOWER |
|---|
| Gene, Accession # | CACFD1, Gene ID: 11094 |
|---|
| Catalog # | NBP1-84307 |
|---|
| Price | |
|---|
| Order / More Info | Calcium Channel Flower Homolog Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|