| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SET1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SET1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to SET1B. This antibody reacts with human. The SET1B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SET1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DSLGMEEEVDIETEAVAPEERPSMLDEPPLPVGVEEPADSREPPEEPGLSQEGAMLLSPEPPAKEVEARPPLSPER |
|---|
| Other Names | EC 2.1.1, FLJ20803, histone-lysine N-methyltransferase SETD1B, hSET1B, KIAA1076EC 2.1.1.43, KMT2GSET1B, Lysine N-methyltransferase 2G, SET domain containing 1B, SET domain-containing protein 1B, Set1B |
|---|
| Gene, Accession # | SETD1B, Gene ID: 23067 |
|---|
| Catalog # | NBP1-87896 |
|---|
| Price | |
|---|
| Order / More Info | SET1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|