| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NPAS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NPAS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NPAS1. This antibody reacts with human. The NPAS1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NPAS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VLWVSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGQRIKV |
|---|
| Other Names | Basic-helix-loop-helix-PAS protein MOP5, BHLHE11, bHLHe11member of PAS superfamily 5, Class E basic helix-loop-helix protein 11, Member of PAS protein 5, MOP5Neuronal PAS1, neuronal PAS domain protein 1, neuronal PAS domain-containing protein 1, PASD5PAS domain-containing protein 5 |
|---|
| Gene, Accession # | NPAS1, Gene ID: 4861 |
|---|
| Catalog # | NBP2-58842 |
|---|
| Price | |
|---|
| Order / More Info | NPAS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|