| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NPAS2 |
|---|
| Clone | 3B1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NPAS2 Antibody (3B1) from Novus Biologicals is a mouse monoclonal antibody to NPAS2. This antibody reacts with human. The NPAS2 Antibody (3B1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | NPAS2 (NP_002509 646 a.a. - 738 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NLTTPASTSQDASQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPANSSSAPMPVLLMGQAVLH |
|---|
| Other Names | Basic-helix-loop-helix-PAS protein MOP4, BHLHE9, bHLHe9MGC71151, Class E basic helix-loop-helix protein 9, Member of PAS protein 4, member of PAS superfamily 4, MOP4PAS domain-containing protein 4, neuronal PAS domain protein 2, neuronal PAS domain-containing protein 2, Neuronal PAS2, PASD4FLJ23138 |
|---|
| Gene, Accession # | NPAS2, Gene ID: 4862, Accession: NP_002509, SwissProt: NP_002509 |
|---|
| Catalog # | H00004862-M04 |
|---|
| Price | |
|---|
| Order / More Info | NPAS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|