| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SET |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SET Antibody from Novus Biologicals is a rabbit polyclonal antibody to SET. This antibody reacts with human, mouse. The SET Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SET(SET nuclear oncogene) The peptide sequence was selected from the N terminal of SET. Peptide sequence IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT. |
|---|
| Other Names | 2PP2A, HLA-DR-associated protein II, I2PP2A, I-2PP2A, IGAAD, Inhibitor of granzyme A-activated DNase, inhibitor-2 of protein phosphatase-2A, IPP2A2, PHAPIITAF-I, Phosphatase 2A inhibitor I2PP2A, protein phosphatase type 2A inhibitor, protein SET, SET nuclear oncogene, SET translocation (myeloid leukemia-associated), TAF-IBETA, Template-activating factor I, Template-Activating Factor-I, chromatin remodelling factor |
|---|
| Gene, Accession # | SET, Gene ID: 6418, Accession: B2RCX0, SwissProt: B2RCX0 |
|---|
| Catalog # | NBP1-58201 |
|---|
| Price | |
|---|
| Order / More Info | SET Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|