| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | p15INK4b/CDKN2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The p15INK4b/CDKN2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to p15INK4b/CDKN2B. This antibody reacts with human. The p15INK4b/CDKN2B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human p15INK4b/CDKN2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG |
|---|
| Other Names | CDK4I, cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4), cyclin-dependent kinases 4 and 6 binding protein, INK4BCDK4B inhibitor, MTS-2, MTS2CDK inhibitory protein, Multiple tumor suppressor 2, p14_CDK inhibitor, p14_INK4B, p14-INK4b, p15 CDK inhibitor, p15_INK4B, P15cyclin-dependent kinase 4 inhibitor B, p15INK4b, p15-INK4b, TP15 |
|---|
| Gene, Accession # | CDKN2B, Gene ID: 1030, Accession: P42772, SwissProt: P42772 |
|---|
| Catalog # | NBP2-38023 |
|---|
| Price | |
|---|
| Order / More Info | p15INK4b/CDKN2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|