| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | p19 INK4d |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The p19 INK4d Antibody from Novus Biologicals is a rabbit polyclonal antibody to p19 INK4d. This antibody reacts with human. The p19 INK4d Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human p19 INK4d antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR |
|---|
| Other Names | CDK inhibitor p19INK4d, cell cycle inhibitor, Nur77 associating protein, cyclin-dependent kinase 4 inhibitor D, cyclin-dependent kinase 4 inhibitor D p19, cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), inhibitor of cyclin-dependent kinase 4d, INK4D, p19, p19-INK4D |
|---|
| Gene, Accession # | CDKN2D, Gene ID: 1032 |
|---|
| Catalog # | NBP2-58778 |
|---|
| Price | |
|---|
| Order / More Info | p19 INK4d Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|