| Edit |   |
|---|
| Antigenic Specificity | Desmoglein-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Desmoglein-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Desmoglein-4. This antibody reacts with human. The Desmoglein-4 Antibody has been validated for the following applications: Immunohistochemistry. Specificity of human Desmoglein-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DLDTGNPATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTATGTICIEVPDINDYCPNIFPERRTICIDSP |
|---|
| Other Names | Cadherin family member 13, CDGF13, CDHF13CDH family member 13, desmoglein 4, LAHdesmoglein-4 |
|---|
| Gene, Accession # | DSG4, Gene ID: 147409, Accession: Q86SJ6, SwissProt: Q86SJ6 |
|---|
| Catalog # | NBP2-31770 |
|---|
| Price | |
|---|
| Order / More Info | Desmoglein-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|