| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PI 3-Kinase C2 beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PI 3-Kinase C2 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI 3-Kinase C2 beta. This antibody reacts with human. The PI 3-Kinase C2 beta Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PI 3-Kinase C2 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY |
|---|
| Other Names | C2-PI3KDKFZp686G16234, EC 2.7.1, EC 2.7.1.154, phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide, phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit beta, Phosphoinositide 3-kinase-C2-beta, phosphoinositide-3-kinase, class 2, beta polypeptide, PI3K-C2beta, PI3K-C2-beta, PTDINS-3-kinase C2 beta, PtdIns-3-kinase C2 subunit beta |
|---|
| Gene, Accession # | PIK3C2B, Gene ID: 5287 |
|---|
| Catalog # | NBP2-58352 |
|---|
| Price | |
|---|
| Order / More Info | PI 3-Kinase C2 beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|