| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Acetyl-CoA Carboxylase alpha/ACACA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Acetyl-CoA Carboxylase alpha/ACACA Antibody from Novus Biologicals is a rabbit polyclonal antibody to Acetyl-CoA Carboxylase alpha/ACACA. This antibody reacts with human. The Acetyl-CoA Carboxylase alpha/ACACA Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Acetyl-CoA Carboxylase alpha/ACACA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
|---|
| Other Names | ACACacetyl-CoA carboxylase 1, ACC1ACC, ACCA, ACC-alpha, acetyl-CoA carboxylase alpha, acetyl-Coenzyme A carboxylase alpha, EC 6.4.1.2 |
|---|
| Gene, Accession # | ACACA, Gene ID: 31 |
|---|
| Catalog # | NBP2-55439 |
|---|
| Price | |
|---|
| Order / More Info | Acetyl-CoA Carboxylase alpha/ACACA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|